answersLogoWhite

0


Best Answer

Words that rhyme with plain are mane, rain, strain, chain, and crane. Other words that rhyme with the word plain are pane, lane, train, restrain, complain, retain, explain, domain, main, plane, sane, vein, vain, campaign and grain, but there are MANY more.

User Avatar

Wiki User

βˆ™ 9y ago
This answer is:
User Avatar

Add your answer:

Earn +20 pts
Q: What words rhyme with plain?
Write your answer...
Submit
Still have questions?
magnify glass
imp
Related questions

Words that rhyme with rain with ai in it that starts with p?

Plain and pain.


Does in rhyme with out?

No. The word "in" does not rhyme with out.Examples of words that rhyme with out:AboutBoutCloutDoubtFloutGoutGroutLoutPoutRoutShoutSnoutStoutToutTroutExamples of words that rhyme with in:BinDinFinGinHenMenSinTenTinWhenWenWinYenYinZen


What words rhyme with gays?

Words that Rhyme with gays:baysblazebraiseclaysdaysdazeflaysglazegreysgrazehazejayslaysmazemaizeMaysneighsnayspaysphraseplayspraysraysslaysspaysspraysstaysstraystazetrayswaysWaze


How many words rhyme with yule?

30 words rhyme with yule.Some words that rhyme with yule:CoolCruelDroolDuelFerruleFeruleFoolFuelGhoulJewelMinisculeMinusculeMisruleMoleculeMuleOverrulePlayschoolPoolPuleRetoolRidiculeRuleSchoolSpoolStoolToolTulleUncoolVestibuleYou'll


What words rhyme with loop?

Words that rhyme with loop include:coopcroupdroophooppoopstoopsouptroop


What is an external rhyme?

External rhyme is rhyme that happens on the "outside" of the poem. In other words, the words at the end of the lines rhyme.


Does eight rhyme with right?

No it doesn't.Some words that rhyme with right are:biteblightbrightbytecitefightflightfrightheightkiteknightlightmightmitenightplightquiteritesightsitesleightslightspitespritetighttritewhitewrightwriteSome words that rhyme with eight are:atebaitbatedatefategatehatelatematepateplateratesatetraitwaitweight


What words rhyme with looks?

Words that rhyme with looks include:booksbrooksChinookscookscrookshooksnooks,rooksschnook


What is the term for when the middle of words rhyme?

The term for when the middle of words rhyme is called "internal rhyme." It occurs when words within the same line of poetry rhyme with each other.


What is rhyme free verse?

no words rhyme


How many words rhyme with lower?

There are 29 words and phrases that rhyme with lower.


How many words rhyme with zoo?

There are 618 words and phrases that rhyme with zoo.