0
Words that rhyme with plain are mane, rain, strain, chain, and crane. Other words that rhyme with the word plain are pane, lane, train, restrain, complain, retain, explain, domain, main, plane, sane, vein, vain, campaign and grain, but there are MANY more.
Add your answer:
Earn +20 pts
Through what countries do the Great Northern European Plains fall?
The Great Northern European Plain encompass portions of the following countries: England France, Belgium, The Netherlands, Germany, Poland, Denmark, the Czech Republic, and Sweden. This plain continues and is then called the East European Plain.
Are ed koch and Charles koch brothers?
Not only are they not related, but they say their last name differently. The former mayor of New York, Ed Koch, says it to rhyme with "watch." Charles Koch, of the Koch brothers, pronounces his name to rhyme with "stroke."
Do evil and devil rhyme?
No. Evil is said with a long E. Devil is said with a short E.
Why is the Gangetic Plain important to India?
It is the fertile lowland region of north-central India.
What is an excerpt from plain truth by James chalmers (1776) paragraph?
We don’t have your excerpt to help you.
Words that rhyme with rain with ai in it that starts with p?
Plain and pain.
Does in rhyme with out?
No. The word "in" does not rhyme with out.Examples of words that rhyme with out:AboutBoutCloutDoubtFloutGoutGroutLoutPoutRoutShoutSnoutStoutToutTroutExamples of words that rhyme with in:BinDinFinGinHenMenSinTenTinWhenWenWinYenYinZen
What words rhyme with gays?
Words that Rhyme with gays:baysblazebraiseclaysdaysdazeflaysglazegreysgrazehazejayslaysmazemaizeMaysneighsnayspaysphraseplayspraysraysslaysspaysspraysstaysstraystazetrayswaysWaze
How many words rhyme with yule?
30 words rhyme with yule.Some words that rhyme with yule:CoolCruelDroolDuelFerruleFeruleFoolFuelGhoulJewelMinisculeMinusculeMisruleMoleculeMuleOverrulePlayschoolPoolPuleRetoolRidiculeRuleSchoolSpoolStoolToolTulleUncoolVestibuleYou'll
What words rhyme with loop?
Words that rhyme with loop include:coopcroupdroophooppoopstoopsouptroop
What is an external rhyme?
External rhyme is rhyme that happens on the "outside" of the poem. In other words, the words at the end of the lines rhyme.
Does eight rhyme with right?
No it doesn't.Some words that rhyme with right are:biteblightbrightbytecitefightflightfrightheightkiteknightlightmightmitenightplightquiteritesightsitesleightslightspitespritetighttritewhitewrightwriteSome words that rhyme with eight are:atebaitbatedatefategatehatelatematepateplateratesatetraitwaitweight
What words rhyme with looks?
Words that rhyme with looks include:booksbrooksChinookscookscrookshooksnooks,rooksschnook
What is the term for when the middle of words rhyme?
The term for when the middle of words rhyme is called "internal rhyme." It occurs when words within the same line of poetry rhyme with each other.
What is rhyme free verse?
no words rhyme
How many words rhyme with lower?
There are 29 words and phrases that rhyme with lower.
How many words rhyme with zoo?
There are 618 words and phrases that rhyme with zoo.
