Mules, tools, fools, etc.
Harold, Gerald, Ronald
The "i" before "e" rule is almost never fully stated in its entirety. The complete rule goes like this: "I" before "E" except after C, or when sounded like "I" as in the words Einstein, height, sleight, stein. or "A" as in the words neighbor, weigh, sleigh, heir, their. The rule can get even wordier if you want to include this section: "Neither, weird, foreign, leisure, seize, forfeit are common exceptions spelled right But don't let the C-I-E-N words get you uptight." These C-I-E-N words include Science, Ancient, Sufficient. There are no C-E-I-N words in the English language. Also to note, depending on how you pronounce "neither" it may not be an exception. So in addition to those exceptions mentioned in the wordier addition to the rule, these are a few other exceptions: Protein, caffeine, heifer, codeine, counterfeit, either, sovereign, and surfeit. Proper names don't have to necessarily follow any rules.
a king rules a small area (simular to a state) and an emperer rules many kingdoms (simular to a country)
Government
England
It is against the rules of this site to use mean words.
It is against the rules of WikiAnswers to put dirty words in answers or questions.
No. The word "in" does not rhyme with out.Examples of words that rhyme with out:AboutBoutCloutDoubtFloutGoutGroutLoutPoutRoutShoutSnoutStoutToutTroutExamples of words that rhyme with in:BinDinFinGinHenMenSinTenTinWhenWenWinYenYinZen
30 words rhyme with yule.Some words that rhyme with yule:CoolCruelDroolDuelFerruleFeruleFoolFuelGhoulJewelMinisculeMinusculeMisruleMoleculeMuleOverrulePlayschoolPoolPuleRetoolRidiculeRuleSchoolSpoolStoolToolTulleUncoolVestibuleYou'll
Words that Rhyme with gays:baysblazebraiseclaysdaysdazeflaysglazegreysgrazehazejayslaysmazemaizeMaysneighsnayspaysphraseplayspraysraysslaysspaysspraysstaysstraystazetrayswaysWaze
Words that rhyme with loop include:coopcroupdroophooppoopstoopsouptroop
External rhyme is rhyme that happens on the "outside" of the poem. In other words, the words at the end of the lines rhyme.
Some words that rhyme with fool are:coolcrewelcrueldroolduelghoulgrueljewelmulepoolruleschoolspoolstooltooltulleyule
No it doesn't.Some words that rhyme with right are:biteblightbrightbytecitefightflightfrightheightkiteknightlightmightmitenightplightquiteritesightsitesleightslightspitespritetighttritewhitewrightwriteSome words that rhyme with eight are:atebaitbatedatefategatehatelatematepateplateratesatetraitwaitweight
Not necessarily. Different languages have different phonetic systems and rules for rhyming, so words that rhyme in one language may not rhyme in another. Additionally, languages may have different sounds that are associated with rhyming.
The term for when the middle of words rhyme is called "internal rhyme." It occurs when words within the same line of poetry rhyme with each other.
Words that rhyme with looks include:booksbrooksChinookscookscrookshooksnooks,rooksschnook