0
What else can I help you with?
What people's names rhyme with world?
Harold, Gerald, Ronald
Which of these words is spelled incorrectly because it violates the rules for ie versus ei words or exceptions to those rules?
The "i" before "e" rule is almost never fully stated in its entirety. The complete rule goes like this: "I" before "E" except after C, or when sounded like "I" as in the words Einstein, height, sleight, stein. or "A" as in the words neighbor, weigh, sleigh, heir, their. The rule can get even wordier if you want to include this section: "Neither, weird, foreign, leisure, seize, forfeit are common exceptions spelled right But don't let the C-I-E-N words get you uptight." These C-I-E-N words include Science, Ancient, Sufficient. There are no C-E-I-N words in the English language. Also to note, depending on how you pronounce "neither" it may not be an exception. So in addition to those exceptions mentioned in the wordier addition to the rule, these are a few other exceptions: Protein, caffeine, heifer, codeine, counterfeit, either, sovereign, and surfeit. Proper names don't have to necessarily follow any rules.
WHAT IS the difference between a king and a empire?
a king rules a small area (simular to a state) and an emperer rules many kingdoms (simular to a country)
What is an institution that rules a nation-state?
Government
What were King George's III rules?
England
What are some mean words that rhyme with fire?
It is against the rules of this site to use mean words.
What are dirty words that rhyme with Angie?
It is against the rules of WikiAnswers to put dirty words in answers or questions.
Does in rhyme with out?
No. The word "in" does not rhyme with out.Examples of words that rhyme with out:AboutBoutCloutDoubtFloutGoutGroutLoutPoutRoutShoutSnoutStoutToutTroutExamples of words that rhyme with in:BinDinFinGinHenMenSinTenTinWhenWenWinYenYinZen
What words rhyme with gays?
Words that Rhyme with gays:baysblazebraiseclaysdaysdazeflaysglazegreysgrazehazejayslaysmazemaizeMaysneighsnayspaysphraseplayspraysraysslaysspaysspraysstaysstraystazetrayswaysWaze
How many words rhyme with yule?
30 words rhyme with yule.Some words that rhyme with yule:CoolCruelDroolDuelFerruleFeruleFoolFuelGhoulJewelMinisculeMinusculeMisruleMoleculeMuleOverrulePlayschoolPoolPuleRetoolRidiculeRuleSchoolSpoolStoolToolTulleUncoolVestibuleYou'll
What words rhyme with loop?
Words that rhyme with loop include:coopcroupdroophooppoopstoopsouptroop
What is an external rhyme?
External rhyme is rhyme that happens on the "outside" of the poem. In other words, the words at the end of the lines rhyme.
Does eight rhyme with right?
No it doesn't.Some words that rhyme with right are:biteblightbrightbytecitefightflightfrightheightkiteknightlightmightmitenightplightquiteritesightsitesleightslightspitespritetighttritewhitewrightwriteSome words that rhyme with eight are:atebaitbatedatefategatehatelatematepateplateratesatetraitwaitweight
What words rhyme with looks?
Words that rhyme with looks include:booksbrooksChinookscookscrookshooksnooks,rooksschnook
What is the term for when the middle of words rhyme?
The term for when the middle of words rhyme is called "internal rhyme." It occurs when words within the same line of poetry rhyme with each other.
What rhymes with foolery?
Some words that rhyme with fool are:coolcrewelcrueldroolduelghoulgrueljewelmulepoolruleschoolspoolstooltooltulleyule
What is rhyme free verse?
no words rhyme
